Biology:Blepharisma nuclear code

From HandWiki
Revision as of 06:00, 26 October 2022 by imported>Carolyn (update)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Short description: An alternative genetic code found in the nuclear genome of some heterotrich ciliates


The Blepharisma nuclear code (translation table 15) is a genetic code found in the nuclei of Blepharisma.[1]

Code

   AAs = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

DNA codons RNA codons This code (15) Standard code (1)
TAG UAG Gln (Q) STOP = Ter (*)

Systematic range and comments

Ciliata: Blepharisma[2]

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [3]

  1. "The Genetic Codes". National Center for Biotechnology Information. 26 September 1996. Archived from the original on 14 March 2016. https://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15. Retrieved 20 January 2017. 
  2. A Liang, K Heckman (1993). "Blepharisma uses UAA as a termination codon". Naturwissenschaften 80 (5): 225–226. doi:10.1007/bf01175738. PMID 7685500. Bibcode1993NW.....80..225L. 
  3. Elzanowski, Andrzej; Ostell, Jim; Leipe, Detlef; Soussov, Vladimir. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop.